PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023919.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 1698aa    MW: 184675 Da    PI: 6.2258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023919.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.3e-11789832247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE el+++  + +G++ +++Ia+ +  ++t  +c+++++k+
      Pbr023919.1 789 NPWTPEEKELFIQKLTTYGKD-FRKIASFLD-HKTTADCVEFYYKH 832
                      69*****************99.*********.************97 PP

2Myb_DNA-binding331.4e-1010081048345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE  ++++av  +G++ ++ Iar++   R+  qck ++ 
      Pbr023919.1 1008 DWTDEEKSRFIQAVSSYGKD-FDMIARCIR-SRSQQQCKVFFS 1048
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.04E-15774834IPR009057Homeodomain-like
PROSITE profilePS5129317.482786837IPR017884SANT domain
SMARTSM007172.7E-11787835IPR001005SANT/Myb domain
PfamPF002493.5E-8789832IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-7790834IPR009057Homeodomain-like
PROSITE profilePS5129311.64710041055IPR017884SANT domain
SMARTSM007172.9E-810051053IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-1010061055IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-710081049IPR009057Homeodomain-like
PfamPF002491.4E-710081048IPR001005SANT/Myb domain
CDDcd001674.78E-710091047No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1698 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSESLGSVAR WRDSPHHAPR DFNRWASGDF RRPPGHGKQG  60
GWHVFSDDSG HGYGSSRSGD KMVEDESFRP SFSRGDGRYG RNSRDNRGPP YSQRESKGYS  120
WETRSGSPNM PGRPSRVNNE QRSQDDMLTY SSHQQSDFGS TWDQIQLKDQ LDKMGGSTGL  180
GAGQKCEREN SLVSIDWKPL KWTRSGSMSS RGSGFSHSSS SKSMGPIDSN EAKVESQLKT  240
ATPVQSPSGE ATNCVTSAAP LEETTSRKKP RLGWGEGLAK YEKKKVDVPD GSMNKDAAVC  300
SVGNTEPAHS LSSSLPDKSP RVTAFSDCAS PATPSSVACS SSPGVEEKSF CKAVNVENDT  360
RNSCGSPGPM YQSHHEGFSF QLENLDGNSI VNLDSSILEL LQSDDPSSVD SSIPRPTALN  420
KLLIWKGEIS KVLEVTESEI DSLENELKAL KSDSGGCCPR PATSSSLPVE EKDKSCKEQV  480
TNLTTRLSPL QIHSSGDTDL QKMCVDNGEQ VEFCGIVKDE DIDSPGTATS KFVESLPLVS  540
SNMMNKTGGS EDRDPIQTTK GEETCLVPSR YAEKTDPSTC GNSSMLLDSE VVALDSGVVD  600
KLCDSIFSAN KIFASRASDI FSKLLPKEHI SGVSVSSSWK NDSLIKEKFA KRKRRLRFME  660
RVITLKFKAF QHLWKEDMSV LSMQKCRPKS HKKFELSLRA TNNGHQKHRS SIRSRFSTPA  720
GSLSVIPTTE IINFTNKLLS DSQVKPYRNS LKMPALILDK EEKLATRFVS SNGLVEDPCA  780
VEKERALMNP WTPEEKELFI QKLTTYGKDF RKIASFLDHK TTADCVEFYY KHHKSDCFVK  840
TKKKPDMAKQ GKSSANTYLI SDGKKWNREM DAASLDILGA ASAITAHADG GTRNRQTYSR  900
RLILGGYRNT NTSRAEDTTV ERSCSLDTIG NERETAAADV LAGICGSMSS EAVSSCITSS  960
IDPGESYLEW KYQKGDSVVR RPLTPDVMQN VDDETCSDES CGEMDPSDWT DEEKSRFIQA  1020
VSSYGKDFDM IARCIRSRSQ QQCKVFFSKA RKCLGLDLVH PGPGNGTSVG DDANGGGSDA  1080
EDACVLETGS GISSDKSGCN MNEDVPLSVT NMNEDEADPA ETMKLQTSPP RPEENNVMGE  1140
VDHGDGKPLK SLASDAFQAV DKPKLLFDGD TDIMESNAMG GNATENKILV AESRPVGEGI  1200
NSDPPNPECM VGEKLVSQIS SDRFGKKLEG GDERSNRDPS GCCLPASAHN SCGNTSDVAT  1260
DGSCSAPGLN PECPNQVSVE LNSVQKPSVI SLPHGNAPAT AVSVPQDSAV IECEKSLSQD  1320
RMSSTLDLRE GSVGRDESRK HLSGLPVHAN VEASQVLRGY PLEMVPKKET NGDVSCGNLS  1380
EVKPDRNING HYMTQDGFLQ FGNSKPQCSR VDCPPVPLKV EQPGDARKAH SWSSNGDVKL  1440
FGKILSNPSS SSKPNGSIHE NEEEGAHNQK FSNKSSNLNL TGHHSAHGNS PLLKFDCSSY  1500
LGLENVPSRS YGGFWEGNKV QAGYSSFPDS AILLAKYPAA FSNFPTSSSQ MEQQPLQAVV  1560
KTSDQSMNGI SVFRGEEINV SNGVADYPVF SRGLDGGNKV QPFTVDVKQQ QQRQDVFDIP  1620
KRNGFDAISS IQQQGRGSVG MNVVGRGGIL VGGPCTVSDP VAAIRMHYAK TEQYGGQAGT  1680
IFRKEESWRG GKGDIGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D1e-15753838993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C1e-15753838993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009333718.10.0PREDICTED: uncharacterized protein LOC103926634 isoform X1
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein